SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A069DRG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A069DRG2
Domain Number 1 Region: 97-259
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.57e-29
Family CRAL/TRIO domain 0.0004
Further Details:      
 
Domain Number 2 Region: 5-74
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000000000157
Family CRAL/TRIO N-terminal domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A069DRG2
Sequence length 288
Comment (tr|A0A069DRG2|A0A069DRG2_9HEMI) Putative phosphatidylinositol transfer protein sec14 {ECO:0000313|EMBL:JAC86490.1} OX=65343 OS=Panstrongylus megistus. GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Panstrongylus.
Sequence
SKDEEYKRNKKLKQSDVSIIQEWIKKQPHLPQLNDNQIIMFLRACEYSLEQTKETIDLNY
TMRTKLPEFFAQRDLKRKTIEISMEYLELSVLPERHEDTVVVIYKLKEMDMSKYLFEEYV
KLSNMVLDITHLELGSAHGYNYIHDLKHFTFNHILQTPITSLANTLKYLQEASTCNIRGI
HFINGGTVFEKLLAVIKPFLNAEVMKMIKLHPNYESLRKTLNVKAIPSDYGGEAPSLQEL
NKKTLATLKLYEDWFPEEEKQRNDEKKRTSNLNKDYGIQGSFRKLDLD
Download sequence
Identical sequences A0A069DRG2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]