SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A069DZB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A069DZB0
Domain Number 1 Region: 201-554
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.71e-79
Family Protein kinases, catalytic subunit 0.000000574
Further Details:      
 
Domain Number 2 Region: 50-199
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.24e-39
Family Regulator of G-protein signaling, RGS 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A069DZB0
Sequence length 583
Comment (tr|A0A069DZB0|A0A069DZB0_9HEMI) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} OX=65343 OS=Panstrongylus megistus. GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Panstrongylus.
Sequence
WERVVLGPENGKTFKLELMELENIVANTVYLKAREGGADSNKGKSKKWKKILQFPHVSQC
LHLKNKIDIKYSYVVDQQPIGRLLFRQFCEVERSEYHRYNVFLDAIEKYEIESDENRIEQ
AHIVYDTYLKRDAPSPIDVLNTSLIEACKEKLTSGNRELFDDVMATVKTFLAGEPFQLFE
SSMYFHRYLQWKWLESQPVTYKTFRMYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRI
KKRKGEAMVLIEKQILQKINSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNMGGDP
GFDIPRARFYAAEVLCGLEHLHYQGLVYRDCKPENILLDDAGHVRISDLGLAVEIPEGEM
VRGRVGTVGYMAPEVIDNEKYTFSPDWFSFGCLVFEMIEGQAPFRARKEKVKREEVDRRV
KSDQEKYSAKFTDDAKSLCKQLLKKSSKARLGCHCGRYGAKEVKQHEFFKSTNWKRLEAG
MVEPPFVPDPHAVYAKDVLDIEQFSTVKGVNLDATDDTFYSKFNTGSVSIPWQTEMIETE
CYKELNVFGPNNTPSADLILNAVPQPEKKGCFPFRRKVSCSEL
Download sequence
Identical sequences A0A069DZB0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]