SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A069E407 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A069E407
Domain Number 1 Region: 26-180
Classification Level Classification E-value
Superfamily Lipocalins 5.92e-44
Family Retinol binding protein-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A069E407
Sequence length 182
Comment (tr|A0A069E407|A0A069E407_9RHOB) Outer membrane lipoprotein Blc {ECO:0000256|PIRNR:PIRNR036893} KW=Complete proteome OX=1280949 OS=Hyphomonas adhaerens MHS-3. GN=HAD_03420 OC=Hyphomonadaceae; Hyphomonas.
Sequence
MRLALPAFAAVLLAACTSQPDYREETAAPSTVPSVDLTRYAGLWYEIARYPNRFERDCTG
VTAEYGLKDDGTVSVTNTCFEGSLDGEKKVAEGRARVVEGSGNSQLKVKFAPSWVPFAEG
DYWILALEPDYSASLVGSPDGKYLWILSRTPQLAPAKLEGLKQRAEDLGYETAPLEMTVQ
PQ
Download sequence
Identical sequences A0A069E407 A0A2E3JVZ2
WP_035569439.1.66540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]