SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A069E4W9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A069E4W9
Domain Number 1 Region: 5-125
Classification Level Classification E-value
Superfamily LigT-like 0.000000000157
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A069E4W9
Sequence length 164
Comment (tr|A0A069E4W9|A0A069E4W9_9RHOB) Uncharacterized protein {ECO:0000313|EMBL:KCZ85128.1} KW=Complete proteome OX=1280949 OS=Hyphomonas adhaerens MHS-3. GN=HAD_05585 OC=Hyphomonadaceae; Hyphomonas.
Sequence
MVTYWCTPCAEDAARYRAVIKALALAQGAPAYQAHLTLGTLERAASDLSEVVAALKGLVL
EPVGIGETDVFTKSLFVQFEASDTLLAARRQLETVQGFRQGRAFDPHISLCYGAPPEGSA
ARRDVQDLLSKPVRFDRLIAVNITLPIETYADVMACTVAETFEI
Download sequence
Identical sequences A0A069E4W9
WP_035569891.1.66540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]