SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A069EX63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A069EX63
Domain Number 1 Region: 133-268
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.98e-39
Family AadK C-terminal domain-like 0.00015
Further Details:      
 
Domain Number 2 Region: 3-127
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 7.68e-29
Family AadK N-terminal domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A069EX63
Sequence length 279
Comment (tr|A0A069EX63|A0A069EX63_9BACL) Adenylyltransferase {ECO:0000313|EMBL:KDN58004.1} KW=Complete proteome OX=1484479 OS=Exiguobacterium sp. AB2. GN=DI14_03005 OC=Bacillales Family XII. Incertae Sedis; Exiguobacterium.
Sequence
MTNERVLERLREFVSRDDNVRVFVLNGSLANPDVQRDRYQDVDVTCFVEDVNAFIEDRSW
MGPLGDVLIMQTPDEIPGHADYERFAFLVQFAAGHRVDLTVRPLEAVAATLAADSLSLVL
IDKDDIAGQPVPSDDTYRIKRPTRFDYEQCWNEFWWVSLYVVKGINRKQLLYAYDHLTIM
RTMLRQMLSFEVGFQTGFTVNVGKSGDGLSQHVSRECWEAYLDTYPVIETTSLESAHRQL
IDLFEQVSRRVADQSGIPFQEAEARRIRDAYSTLWCQRD
Download sequence
Identical sequences A0A069EX63
WP_034807785.1.97012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]