SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A069EYQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A069EYQ5
Domain Number 1 Region: 45-100
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000536
Family SMI1/KNR4-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A069EYQ5
Sequence length 103
Comment (tr|A0A069EYQ5|A0A069EYQ5_9BACL) Uncharacterized protein {ECO:0000313|EMBL:KDN58948.1} KW=Complete proteome OX=1484479 OS=Exiguobacterium sp. AB2. GN=DI14_13830 OC=Bacillales Family XII. Incertae Sedis; Exiguobacterium.
Sequence
MTKEQLLALLPTSEIEIQLKDAEGLPRFAFLNERGRFDEVQGEVFDEEEPWPNHLPVIGY
EDFLGDLVCVNLKTNEVLIVDHETGEHLETIAASFEEWLQTER
Download sequence
Identical sequences A0A069EYQ5
WP_034805510.1.97012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]