SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A069IBY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A069IBY9
Domain Number 1 Region: 13-136
Classification Level Classification E-value
Superfamily PapD-like 6.02e-36
Family Pilus chaperone 0.00047
Further Details:      
 
Domain Number 2 Region: 130-228
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 0.000000000127
Family Periplasmic chaperone C-domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A069IBY9
Sequence length 236
Comment (tr|A0A069IBY9|A0A069IBY9_9BURK) Molecular chaperone {ECO:0000313|EMBL:KDP87117.1} KW=Complete proteome; Reference proteome OX=1470558 OS=Cupriavidus sp. SK-3. GN=CF70_003385 OC=Burkholderiaceae; Cupriavidus.
Sequence
MLALLLCLAPAGALAALSIIGTRFVYPADLSALSVRLRNAGDSPILVQAWLDQGEVDADP
ATLRVPFILSPPLLRLDPERKTVLRLRYTGEPLPGDRESVFWINFLEVPPLAEDSASLLR
LSYRTRMKLLFRPAGLPGTADEAIGQVTWAFGKAGKAGGAVLEATNPTPYHVSLARMEVG
RGGALAELDGLTIAPLGVTRFVLPGLAGPAADEAVVHYEAVRDSGELIVGNANVKR
Download sequence
Identical sequences A0A069IBY9
WP_035865102.1.47822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]