SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A069JQR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A069JQR1
Domain Number 1 Region: 25-102,129-170
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000562
Family SMI1/KNR4-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A069JQR1
Sequence length 208
Comment (tr|A0A069JQR1|A0A069JQR1_9NOCA) Uncharacterized protein {ECO:0000313|EMBL:KDQ04062.1} KW=Complete proteome OX=334542 OS=Rhodococcus qingshengii. GN=BXO91_03625 OC=Rhodococcus.
Sequence
MSVANEWSRIEAWCRTHAPVTAAAFQPGLGDAVIEEFEASTGVTWPQELRDLYRVHNGSL
THDDRTGLFLGSVLPDKFFYPIDVATEVRLTLLETWDETIYENPDLYADDEMDRHDQRDA
GTAATMFIPSFVPFAGLDEYHYFVDTRSGALHHCVTEYASDATDNGGPIWASISVMLAAH
AVALETGSTIGVWKPVVSKGVLEWEVDA
Download sequence
Identical sequences A0A069JQR1
WP_030536068.1.23831 WP_030536068.1.48667 WP_030536068.1.85987 WP_030536068.1.88476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]