SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A069K008 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A069K008
Domain Number 1 Region: 32-141
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000126
Family SMI1/KNR4-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A069K008
Sequence length 172
Comment (tr|A0A069K008|A0A069K008_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KDQ70353.1} KW=Complete proteome; Reference proteome OX=1487711 OS=Streptomyces sp. NTK 937. GN=DT87_25110 OC=Streptomyces.
Sequence
MRMRERVGQVVAALVKEYFAESPVGTGPRPAIRPPADPGAVDRLERRSGQSFEAGYREFL
SLTDGLEGFPLLLLGCQDREPGGMGEAAEEFRETVLDSGPEDVGLAPGTPLFPVAVNADR
SEGIFLIDAAGQAEERFWWTGEGNSFFFERFADVLAFLHDPGSRAPKETLLP
Download sequence
Identical sequences A0A069K008 A0A1A9CKH1
WP_051673861.1.101174 WP_051673861.1.46143 WP_051673861.1.58104 WP_051673861.1.85736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]