SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A069K078 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A069K078
Domain Number 1 Region: 69-212
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000122
Family SMI1/KNR4-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A069K078
Sequence length 216
Comment (tr|A0A069K078|A0A069K078_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KDQ70674.1} KW=Complete proteome; Reference proteome OX=1487711 OS=Streptomyces sp. NTK 937. GN=DT87_26780 OC=Streptomyces.
Sequence
MIAMSETTEPEDNEVAGVMTTPEEWRVFLKRYGELYVRVRADDEELVDLLDDDQLEVLDR
GGRVELWLGEAPAREEALVASEARLGVRFPPSLRGFFLASDGWTRLDAYVDGVHSCDRVL
WMRDSEAGGRVTETYDSIPGNEDDVQLFRRSVEIARGEDFWLLDPTDVGPDGEWAAYEFA
PKYGDPTKYPSFSALFHSGYENMAEDEDEDEDEDMD
Download sequence
Identical sequences A0A069K078
WP_037880898.1.46143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]