SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A069S5U8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A069S5U8
Domain Number 1 Region: 9-172
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.1e-32
Family SMI1/KNR4-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A069S5U8
Sequence length 176
Comment (tr|A0A069S5U8|A0A069S5U8_BACVU) SMI1 / KNR4 family protein {ECO:0000313|EMBL:KDS45949.1} KW=Complete proteome OX=1339352 OS=Bacteroides vulgatus str. 3975 RP4. GN=M099_3330 OC=Bacteroides.
Sequence
MKQEFEGFDFTNFWDDNYYARKEYISDAPTDELIADVEKELGYKLPASYIWLMKQHNGGI
PFNTCFPTDSPTNWAEDHIAITGIYGIGREKDYSLCGEIGSQFMIDEWGYPEIGVAICDC
PSAGHDMIFLDYRECGPFGEPKVVHIDQESDFKITTLAENFEDFIRGLENAEKYEE
Download sequence
Identical sequences A0A069S5U8 A0A174VPA6 A0A1C7GXG3 A0A1E9B3K3 B3JE75 B5CWW2 D7J4Z8 E5X4D9 I8WVU5
WP_004295476.1.102052 WP_004295476.1.10223 WP_004295476.1.1104 WP_004295476.1.18195 WP_004295476.1.44254 WP_004295476.1.67491 WP_004295476.1.72715 WP_004295476.1.78705 WP_004295476.1.80163 WP_004295476.1.90763 WP_004295476.1.94919 WP_004295476.1.95559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]