SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A069SCF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A069SCF4
Domain Number - Region: 10-71
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.022
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A069SCF4
Sequence length 172
Comment (tr|A0A069SCF4|A0A069SCF4_BACVU) Uncharacterized protein {ECO:0000313|EMBL:KDS50843.1} KW=Complete proteome OX=1339352 OS=Bacteroides vulgatus str. 3975 RP4. GN=M099_3145 OC=Bacteroides.
Sequence
MNITKVLAEEVANKMVEPLEKKINLLHDEQVRITEEVIRKSIPQEITDCFQKFRSYFSVA
YSITLFNGSYEKRVAGLKGFPSANAYYPHIEADREVIEKINKLEIEISAVKDEKTKVYES
VVASLLTLRTFKRIKENFPEAYRHIACYEDKGKTSVSLPIDNIMDTLKKYTV
Download sequence
Identical sequences A0A069SCF4 I8ZKJ9
WP_005852286.1.25291 WP_005852286.1.72715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]