SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A069X6D6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A069X6D6
Domain Number 1 Region: 15-133
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.83e-18
Family SMI1/KNR4-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A069X6D6
Sequence length 136
Comment (tr|A0A069X6D6|A0A069X6D6_ECOLX) Uncharacterized protein {ECO:0000313|EMBL:KDU25557.1} KW=Complete proteome OX=1444252 OS=Escherichia coli 3-373-03_S4_C2. GN=AD17_5089 OC=Enterobacteriaceae; Escherichia.
Sequence
MKKLAQQVVAQGADIRPAKENEITTAEQVLRMQFSPEYKAYLSEFGLIAFGATEISGLGV
PATSHLNILSAIEPLRKGKDYPSQAVPLCDIGDGYYYLYDNQQHKILTWSMINGVVEASG
EKLEAFLLRILFDVRS
Download sequence
Identical sequences A0A069X6D6
WP_001580905.1.13281 WP_001580905.1.14536 WP_001580905.1.18226 WP_001580905.1.34032 WP_001580905.1.36393 WP_001580905.1.43389 WP_001580905.1.44458 WP_001580905.1.44558 WP_001580905.1.46097 WP_001580905.1.47770 WP_001580905.1.53228 WP_001580905.1.54144 WP_001580905.1.56882 WP_001580905.1.60805 WP_001580905.1.67788 WP_001580905.1.69144 WP_001580905.1.72652 WP_001580905.1.83584 WP_001580905.1.97490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]