SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A069XLY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A069XLY4
Domain Number 1 Region: 61-161
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000432
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A069XLY4
Sequence length 164
Comment (tr|A0A069XLY4|A0A069XLY4_ECOLX) Uncharacterized protein {ECO:0000313|EMBL:KDU31188.1} KW=Complete proteome OX=1444252 OS=Escherichia coli 3-373-03_S4_C2. GN=AD17_1961 OC=Enterobacteriaceae; Escherichia.
Sequence
MMTKTQINKLIKMMNDLDYPFEAPLKESFIESIIQIEFNSNSTNCLEKLCNEVSILFKNQ
PDYLTFLRAMDGFEVNGLRLFSLSIPEPSVKNLFAVNEFYRNNDDFINPDLQERLVIGDY
SISIFTYDIKSNFFEIRDNIGTENIFSSFSDFSSFLNEIMDSCS
Download sequence
Identical sequences A0A069XLY4 A0A070SQK8 A0A0A3USN4 A0A0M7N284 A0A125WXX0 A0A1X3JBI8 A0A236HPV2 F4SQH3 G0F7B2 H4UQF6 I2X5B2 T9CJH6
WP_000988499.1.100085 WP_000988499.1.100111 WP_000988499.1.100441 WP_000988499.1.100487 WP_000988499.1.10051 WP_000988499.1.100824 WP_000988499.1.100966 WP_000988499.1.101158 WP_000988499.1.101186 WP_000988499.1.101282 WP_000988499.1.101423 WP_000988499.1.101654 WP_000988499.1.101737 WP_000988499.1.101747 WP_000988499.1.10417 WP_000988499.1.10491 WP_000988499.1.10729 WP_000988499.1.10833 WP_000988499.1.11047 WP_000988499.1.11118 WP_000988499.1.11241 WP_000988499.1.11408 WP_000988499.1.11955 WP_000988499.1.11982 WP_000988499.1.12415 WP_000988499.1.12542 WP_000988499.1.12680 WP_000988499.1.127 WP_000988499.1.12775 WP_000988499.1.12914 WP_000988499.1.1312 WP_000988499.1.13136 WP_000988499.1.13239 WP_000988499.1.13258 WP_000988499.1.13281 WP_000988499.1.13290 WP_000988499.1.13333 WP_000988499.1.13585 WP_000988499.1.14346 WP_000988499.1.14468 WP_000988499.1.1461 WP_000988499.1.14811 WP_000988499.1.14833 WP_000988499.1.14992 WP_000988499.1.15121 WP_000988499.1.15259 WP_000988499.1.15496 WP_000988499.1.15740 WP_000988499.1.15747 WP_000988499.1.1588 WP_000988499.1.16086 WP_000988499.1.1609 WP_000988499.1.16102 WP_000988499.1.16179 WP_000988499.1.16294 WP_000988499.1.1634 WP_000988499.1.16532 WP_000988499.1.16721 WP_000988499.1.16752 WP_000988499.1.17018 WP_000988499.1.17084 WP_000988499.1.17114 WP_000988499.1.17290 WP_000988499.1.17432 WP_000988499.1.17534 WP_000988499.1.1755 WP_000988499.1.17577 WP_000988499.1.18133 WP_000988499.1.18402 WP_000988499.1.18726 WP_000988499.1.18876 WP_000988499.1.19150 WP_000988499.1.19277 WP_000988499.1.193 WP_000988499.1.19313 WP_000988499.1.1982 WP_000988499.1.19889 WP_000988499.1.19940 WP_000988499.1.19957 WP_000988499.1.19994 WP_000988499.1.20151 WP_000988499.1.20318 WP_000988499.1.20445 WP_000988499.1.20506 WP_000988499.1.20536 WP_000988499.1.2063 WP_000988499.1.20638 WP_000988499.1.20724 WP_000988499.1.20737 WP_000988499.1.20943 WP_000988499.1.20982 WP_000988499.1.2100 WP_000988499.1.21033 WP_000988499.1.21122 WP_000988499.1.21251 WP_000988499.1.2142 WP_000988499.1.21470 WP_000988499.1.21573 WP_000988499.1.21661 WP_000988499.1.21733 WP_000988499.1.21758 WP_000988499.1.21771 WP_000988499.1.21823 WP_000988499.1.22363 WP_000988499.1.22450 WP_000988499.1.22574 WP_000988499.1.22632 WP_000988499.1.22669 WP_000988499.1.22690 WP_000988499.1.22878 WP_000988499.1.22885 WP_000988499.1.23044 WP_000988499.1.23090 WP_000988499.1.23549 WP_000988499.1.23945 WP_000988499.1.24045 WP_000988499.1.24124 WP_000988499.1.2418 WP_000988499.1.24362 WP_000988499.1.24583 WP_000988499.1.24899 WP_000988499.1.24960 WP_000988499.1.25141 WP_000988499.1.25324 WP_000988499.1.25525 WP_000988499.1.25643 WP_000988499.1.25713 WP_000988499.1.26048 WP_000988499.1.26379 WP_000988499.1.26480 WP_000988499.1.26609 WP_000988499.1.26941 WP_000988499.1.27134 WP_000988499.1.27260 WP_000988499.1.27451 WP_000988499.1.27560 WP_000988499.1.28128 WP_000988499.1.28268 WP_000988499.1.28271 WP_000988499.1.28509 WP_000988499.1.28662 WP_000988499.1.28711 WP_000988499.1.28919 WP_000988499.1.28982 WP_000988499.1.28994 WP_000988499.1.29061 WP_000988499.1.29128 WP_000988499.1.2945 WP_000988499.1.29746 WP_000988499.1.30231 WP_000988499.1.30247 WP_000988499.1.30472 WP_000988499.1.30479 WP_000988499.1.30497 WP_000988499.1.30546 WP_000988499.1.30630 WP_000988499.1.30639 WP_000988499.1.30749 WP_000988499.1.31379 WP_000988499.1.31407 WP_000988499.1.31614 WP_000988499.1.3169 WP_000988499.1.31833 WP_000988499.1.31839 WP_000988499.1.31978 WP_000988499.1.32127 WP_000988499.1.32143 WP_000988499.1.32479 WP_000988499.1.32509 WP_000988499.1.32903 WP_000988499.1.33325 WP_000988499.1.334 WP_000988499.1.33408 WP_000988499.1.33502 WP_000988499.1.33526 WP_000988499.1.33545 WP_000988499.1.33648 WP_000988499.1.33736 WP_000988499.1.33746 WP_000988499.1.33799 WP_000988499.1.33879 WP_000988499.1.33888 WP_000988499.1.3401 WP_000988499.1.34277 WP_000988499.1.34332 WP_000988499.1.34363 WP_000988499.1.34444 WP_000988499.1.34525 WP_000988499.1.34993 WP_000988499.1.35360 WP_000988499.1.35651 WP_000988499.1.35724 WP_000988499.1.35904 WP_000988499.1.35959 WP_000988499.1.36164 WP_000988499.1.3620 WP_000988499.1.36386 WP_000988499.1.36453 WP_000988499.1.3671 WP_000988499.1.36746 WP_000988499.1.36747 WP_000988499.1.37233 WP_000988499.1.37445 WP_000988499.1.37485 WP_000988499.1.37576 WP_000988499.1.37964 WP_000988499.1.3811 WP_000988499.1.3815 WP_000988499.1.38182 WP_000988499.1.38323 WP_000988499.1.38950 WP_000988499.1.38956 WP_000988499.1.39164 WP_000988499.1.39356 WP_000988499.1.39531 WP_000988499.1.39829 WP_000988499.1.39870 WP_000988499.1.39938 WP_000988499.1.39961 WP_000988499.1.39966 WP_000988499.1.40013 WP_000988499.1.40016 WP_000988499.1.40212 WP_000988499.1.40218 WP_000988499.1.40445 WP_000988499.1.40524 WP_000988499.1.406 WP_000988499.1.40712 WP_000988499.1.40815 WP_000988499.1.40833 WP_000988499.1.40912 WP_000988499.1.40965 WP_000988499.1.4126 WP_000988499.1.41368 WP_000988499.1.41436 WP_000988499.1.41530 WP_000988499.1.41556 WP_000988499.1.41621 WP_000988499.1.41782 WP_000988499.1.41813 WP_000988499.1.41900 WP_000988499.1.42022 WP_000988499.1.42113 WP_000988499.1.42209 WP_000988499.1.42376 WP_000988499.1.4242 WP_000988499.1.42547 WP_000988499.1.42879 WP_000988499.1.42936 WP_000988499.1.4306 WP_000988499.1.43270 WP_000988499.1.44096 WP_000988499.1.44166 WP_000988499.1.44458 WP_000988499.1.44558 WP_000988499.1.44854 WP_000988499.1.4516 WP_000988499.1.45208 WP_000988499.1.45246 WP_000988499.1.45329 WP_000988499.1.45581 WP_000988499.1.45595 WP_000988499.1.4574 WP_000988499.1.46026 WP_000988499.1.46115 WP_000988499.1.46186 WP_000988499.1.46213 WP_000988499.1.46582 WP_000988499.1.46820 WP_000988499.1.46932 WP_000988499.1.4722 WP_000988499.1.47414 WP_000988499.1.47496 WP_000988499.1.47646 WP_000988499.1.4772 WP_000988499.1.47734 WP_000988499.1.47765 WP_000988499.1.47791 WP_000988499.1.48040 WP_000988499.1.48096 WP_000988499.1.48194 WP_000988499.1.48290 WP_000988499.1.4871 WP_000988499.1.48860 WP_000988499.1.48953 WP_000988499.1.49009 WP_000988499.1.49645 WP_000988499.1.49661 WP_000988499.1.49733 WP_000988499.1.49900 WP_000988499.1.5017 WP_000988499.1.50262 WP_000988499.1.50579 WP_000988499.1.51042 WP_000988499.1.51172 WP_000988499.1.51495 WP_000988499.1.51539 WP_000988499.1.51784 WP_000988499.1.51968 WP_000988499.1.52076 WP_000988499.1.52127 WP_000988499.1.52186 WP_000988499.1.52211 WP_000988499.1.52214 WP_000988499.1.52243 WP_000988499.1.52305 WP_000988499.1.52492 WP_000988499.1.52544 WP_000988499.1.52774 WP_000988499.1.52853 WP_000988499.1.53428 WP_000988499.1.53769 WP_000988499.1.53931 WP_000988499.1.53972 WP_000988499.1.53994 WP_000988499.1.54002 WP_000988499.1.54507 WP_000988499.1.54602 WP_000988499.1.54605 WP_000988499.1.54617 WP_000988499.1.54620 WP_000988499.1.54769 WP_000988499.1.54981 WP_000988499.1.55123 WP_000988499.1.55466 WP_000988499.1.55529 WP_000988499.1.55551 WP_000988499.1.55556 WP_000988499.1.55629 WP_000988499.1.55676 WP_000988499.1.55868 WP_000988499.1.56164 WP_000988499.1.56934 WP_000988499.1.56978 WP_000988499.1.57181 WP_000988499.1.57401 WP_000988499.1.57410 WP_000988499.1.57432 WP_000988499.1.57846 WP_000988499.1.5786 WP_000988499.1.58080 WP_000988499.1.58232 WP_000988499.1.58316 WP_000988499.1.58401 WP_000988499.1.5842 WP_000988499.1.58420 WP_000988499.1.58429 WP_000988499.1.58867 WP_000988499.1.58976 WP_000988499.1.59024 WP_000988499.1.59407 WP_000988499.1.59513 WP_000988499.1.59615 WP_000988499.1.59998 WP_000988499.1.6002 WP_000988499.1.60031 WP_000988499.1.60550 WP_000988499.1.6061 WP_000988499.1.60764 WP_000988499.1.60901 WP_000988499.1.61096 WP_000988499.1.61170 WP_000988499.1.61505 WP_000988499.1.61517 WP_000988499.1.61663 WP_000988499.1.61779 WP_000988499.1.61822 WP_000988499.1.62099 WP_000988499.1.62612 WP_000988499.1.62735 WP_000988499.1.62750 WP_000988499.1.62812 WP_000988499.1.62919 WP_000988499.1.62989 WP_000988499.1.6337 WP_000988499.1.63453 WP_000988499.1.64285 WP_000988499.1.64448 WP_000988499.1.64784 WP_000988499.1.64789 WP_000988499.1.64912 WP_000988499.1.65353 WP_000988499.1.65364 WP_000988499.1.65596 WP_000988499.1.66104 WP_000988499.1.66105 WP_000988499.1.66327 WP_000988499.1.6635 WP_000988499.1.66389 WP_000988499.1.66395 WP_000988499.1.66501 WP_000988499.1.6654 WP_000988499.1.66559 WP_000988499.1.66700 WP_000988499.1.67022 WP_000988499.1.67137 WP_000988499.1.67415 WP_000988499.1.67538 WP_000988499.1.67787 WP_000988499.1.67975 WP_000988499.1.6803 WP_000988499.1.6814 WP_000988499.1.68170 WP_000988499.1.68215 WP_000988499.1.68341 WP_000988499.1.68534 WP_000988499.1.68697 WP_000988499.1.6916 WP_000988499.1.69303 WP_000988499.1.69646 WP_000988499.1.70407 WP_000988499.1.70619 WP_000988499.1.70767 WP_000988499.1.70794 WP_000988499.1.70880 WP_000988499.1.71024 WP_000988499.1.71159 WP_000988499.1.71199 WP_000988499.1.71229 WP_000988499.1.71312 WP_000988499.1.71323 WP_000988499.1.71397 WP_000988499.1.71409 WP_000988499.1.71480 WP_000988499.1.71837 WP_000988499.1.71938 WP_000988499.1.71993 WP_000988499.1.7210 WP_000988499.1.72184 WP_000988499.1.72337 WP_000988499.1.72485 WP_000988499.1.72511 WP_000988499.1.72606 WP_000988499.1.72616 WP_000988499.1.72747 WP_000988499.1.72860 WP_000988499.1.72869 WP_000988499.1.73085 WP_000988499.1.73129 WP_000988499.1.73217 WP_000988499.1.73295 WP_000988499.1.73524 WP_000988499.1.73717 WP_000988499.1.73835 WP_000988499.1.73844 WP_000988499.1.73942 WP_000988499.1.7411 WP_000988499.1.74123 WP_000988499.1.74309 WP_000988499.1.74445 WP_000988499.1.74528 WP_000988499.1.74625 WP_000988499.1.74688 WP_000988499.1.74691 WP_000988499.1.7475 WP_000988499.1.74962 WP_000988499.1.75139 WP_000988499.1.75243 WP_000988499.1.75491 WP_000988499.1.75537 WP_000988499.1.75612 WP_000988499.1.75644 WP_000988499.1.75679 WP_000988499.1.75699 WP_000988499.1.75995 WP_000988499.1.76196 WP_000988499.1.76312 WP_000988499.1.76446 WP_000988499.1.76462 WP_000988499.1.76701 WP_000988499.1.77214 WP_000988499.1.77358 WP_000988499.1.77595 WP_000988499.1.77636 WP_000988499.1.77648 WP_000988499.1.77768 WP_000988499.1.77876 WP_000988499.1.78000 WP_000988499.1.78089 WP_000988499.1.78196 WP_000988499.1.78321 WP_000988499.1.78413 WP_000988499.1.7847 WP_000988499.1.78583 WP_000988499.1.78612 WP_000988499.1.78750 WP_000988499.1.78953 WP_000988499.1.79086 WP_000988499.1.79558 WP_000988499.1.79840 WP_000988499.1.7987 WP_000988499.1.79871 WP_000988499.1.79984 WP_000988499.1.80136 WP_000988499.1.80255 WP_000988499.1.80320 WP_000988499.1.80428 WP_000988499.1.80440 WP_000988499.1.80517 WP_000988499.1.8057 WP_000988499.1.80804 WP_000988499.1.80805 WP_000988499.1.80884 WP_000988499.1.8090 WP_000988499.1.81313 WP_000988499.1.81577 WP_000988499.1.81715 WP_000988499.1.81806 WP_000988499.1.81939 WP_000988499.1.82316 WP_000988499.1.8235 WP_000988499.1.82439 WP_000988499.1.82700 WP_000988499.1.82715 WP_000988499.1.82754 WP_000988499.1.83020 WP_000988499.1.8308 WP_000988499.1.831 WP_000988499.1.83140 WP_000988499.1.83224 WP_000988499.1.83537 WP_000988499.1.83735 WP_000988499.1.83941 WP_000988499.1.84331 WP_000988499.1.84405 WP_000988499.1.8444 WP_000988499.1.84534 WP_000988499.1.84584 WP_000988499.1.84697 WP_000988499.1.84740 WP_000988499.1.84977 WP_000988499.1.84994 WP_000988499.1.85002 WP_000988499.1.85216 WP_000988499.1.85247 WP_000988499.1.85260 WP_000988499.1.85310 WP_000988499.1.85621 WP_000988499.1.8592 WP_000988499.1.85948 WP_000988499.1.86001 WP_000988499.1.86161 WP_000988499.1.86412 WP_000988499.1.86691 WP_000988499.1.86787 WP_000988499.1.86959 WP_000988499.1.86997 WP_000988499.1.87199 WP_000988499.1.87574 WP_000988499.1.87655 WP_000988499.1.87721 WP_000988499.1.87857 WP_000988499.1.88017 WP_000988499.1.88110 WP_000988499.1.88607 WP_000988499.1.88729 WP_000988499.1.88834 WP_000988499.1.89090 WP_000988499.1.89416 WP_000988499.1.89468 WP_000988499.1.89674 WP_000988499.1.89923 WP_000988499.1.90078 WP_000988499.1.90168 WP_000988499.1.90256 WP_000988499.1.90511 WP_000988499.1.90520 WP_000988499.1.90536 WP_000988499.1.90864 WP_000988499.1.90951 WP_000988499.1.91277 WP_000988499.1.91341 WP_000988499.1.91462 WP_000988499.1.91551 WP_000988499.1.91739 WP_000988499.1.9215 WP_000988499.1.92161 WP_000988499.1.92180 WP_000988499.1.92496 WP_000988499.1.92568 WP_000988499.1.92614 WP_000988499.1.92615 WP_000988499.1.92742 WP_000988499.1.92845 WP_000988499.1.92943 WP_000988499.1.93054 WP_000988499.1.93175 WP_000988499.1.93276 WP_000988499.1.93312 WP_000988499.1.93652 WP_000988499.1.93911 WP_000988499.1.94025 WP_000988499.1.94176 WP_000988499.1.94271 WP_000988499.1.94388 WP_000988499.1.94445 WP_000988499.1.94738 WP_000988499.1.94764 WP_000988499.1.948 WP_000988499.1.9489 WP_000988499.1.94898 WP_000988499.1.95395 WP_000988499.1.95827 WP_000988499.1.95849 WP_000988499.1.95919 WP_000988499.1.96299 WP_000988499.1.96339 WP_000988499.1.96394 WP_000988499.1.97123 WP_000988499.1.97231 WP_000988499.1.97418 WP_000988499.1.9747 WP_000988499.1.97982 WP_000988499.1.98235 WP_000988499.1.98294 WP_000988499.1.98628 WP_000988499.1.98776 WP_000988499.1.99319 WP_000988499.1.99602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]