SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A071I6Q1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A071I6Q1
Domain Number - Region: 65-95
Classification Level Classification E-value
Superfamily SH3-domain 0.0152
Family SH3-domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A071I6Q1
Sequence length 179
Comment (tr|A0A071I6Q1|A0A071I6Q1_AGRRH) Uncharacterized protein {ECO:0000313|EMBL:KEA07938.1} KW=Complete proteome OX=359 OS=Agrobacterium rhizogenes. GN=CN09_34075 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium.
Sequence
MRGKVLKSCAVFAIGLMMAGATADLAAAQAAKGPSGLPLPRFVTLKSKRVNLRVGPSADY
AVSWLYLKQGLPVEIIQEYDNWRRVRDADGTEGWVNQSLLSGQRSALAAPWMKGKGKAVF
VNMRRDAQPSGTVIAKLQPGVMMNVRECTGDWCLATADGTEGWVAQSEIWGAYPGEAFK
Download sequence
Identical sequences A0A061N1L2 A0A071I6Q1 B9JGV6 J2WZ16
WP_007690257.1.25048 WP_007690257.1.39766 WP_007690257.1.44225 WP_007690257.1.44284 WP_007690257.1.49937 WP_007690257.1.55147 WP_007690257.1.56352 WP_007690257.1.78634 WP_007690257.1.85071 WP_007690257.1.88216 WP_007690257.1.91008 gi|222084348|ref|YP_002542877.1| 311403.Arad_0203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]