SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A071LDC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A071LDC4
Domain Number 1 Region: 4-113
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.7e-34
Family Chaperone J-domain 0.00014
Further Details:      
 
Domain Number 2 Region: 193-268
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 4.58e-16
Family HSP40/DnaJ peptide-binding domain 0.0015
Further Details:      
 
Domain Number 3 Region: 123-190
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.000000000131
Family HSP40/DnaJ peptide-binding domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A071LDC4
Sequence length 285
Comment (tr|A0A071LDC4|A0A071LDC4_9PROT) Cobalamin ABC transporter permease {ECO:0000313|EMBL:KEA46683.1} KW=Complete proteome; Reference proteome OX=202 OS=Campylobacter mucosalis. GN=CR66_02395 OC=Campylobacteraceae; Campylobacter.
Sequence
MSESLYETLGVSKSASADEIKKAYRRLARKYHPDVNKDPGAEDKFKEINAAYEILSDEKK
RAQYDQYGDSMFGGQNFHDFARGSANMGDLNEILKNIFGSGFSSGGFSGGFRGGFDGFGT
PDLDINAKISIPFDVAVLGGEHNINYDGKSIKVKIPAGINNAEKLRIKGKGKSMMGQTGD
LILTVSIEPSNEYERDGDDLIKDALIPLKTMLFGGKFDVKTFKKDVTIKIAPNSKTGTKI
RLKGYGVQNRKSGIYGDLYLKTRVLLPNLDELDPKLVELLKQLPE
Download sequence
Identical sequences A0A071LDC4
WP_034967557.1.45856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]