SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A071LRQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A071LRQ6
Domain Number 1 Region: 62-163
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000118
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A071LRQ6
Sequence length 168
Comment (tr|A0A071LRQ6|A0A071LRQ6_9ENTR) Uncharacterized protein {ECO:0000313|EMBL:KEA51444.1} KW=Complete proteome; Reference proteome OX=1224318 OS=Mangrovibacter sp. MFB070. GN=DT73_17160 OC=Enterobacteriaceae; Mangrovibacter.
Sequence
MNDTKQCINQFKKLMVADKYHVTNPVPAKVMSDLMQSLPPADWDETKQKVFYDIQKLLSI
RPEYAQLFNEMDGLEYNGLTIYSLAQAENGIPSWDNIYIQNLDNRDNDIYASPHLTDKII
IGEDGMSVFCYNFTDNVFEIRDRVAPDYVIESHKDFADFLTALYSTVC
Download sequence
Identical sequences A0A071LRQ6
WP_036111983.1.76242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]