SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A072BXW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072BXW5
Domain Number 1 Region: 160-284
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.01e-32
Family NlpC/P60 0.0024
Further Details:      
 
Domain Number 2 Region: 61-120
Classification Level Classification E-value
Superfamily SH3-domain 0.00000155
Family SH3-domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A072BXW5
Sequence length 285
Comment (tr|A0A072BXW5|A0A072BXW5_RHILP) Endopeptidase protein {ECO:0000313|EMBL:KEC72153.1} KW=Complete proteome OX=1408223 OS=Rhizobium leguminosarum bv. phaseoli CCGM1. GN=RLPCCGM1_c3526 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MTMFDRRLHAYRPDLAEADLEGKVEASRFVQGTPARVAVPVIGLRPQPELARGIDTELLL
GEQVTVFDRADGWCWVKAASDGYVGYVPADALSQIDPVPTHIVTVPRTFLYPEPELRKPH
LTTLSMGSRVHVASEAEARGNHYVVLADGTAIFARHVQPIGAVDGADYVEIAGRFLETPY
LWGGRSGLGIDCSGLVQLAMLMTGRQAPRDADMQAAGLGEAIDRSEIRRGDLVFWKGHVA
IFEDPQTILHANGHSMTVARENFEAAVARIGSLYQQPTGYRRPFK
Download sequence
Identical sequences A0A072BXW5
WP_037142830.1.12474 WP_037142830.1.22132 WP_037142830.1.79970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]