SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A072NP48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072NP48
Domain Number 1 Region: 129-207
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 4.18e-16
Family Copper amine oxidase, domain N 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A072NP48
Sequence length 217
Comment (tr|A0A072NP48|A0A072NP48_BACAZ) Copper amine oxidase family protein {ECO:0000313|EMBL:KEF39027.1} KW=Complete proteome OX=1348973 OS=Bacillus azotoformans MEV2011. GN=M670_01413 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MKFKTIISLIAMFLCNTFFASSAIVSEGSFQDGSNKALKEFEYRQTVEFTKNMNTKEKLG
INTSSNETPGNTISISSDVINQTTEDTIIITTDKEDYYLIEDPLRTVYVNNDKVTFSRNP
VIAKDYTFVPYKLTFLIFGLNAEWDKENNKIIAIKDEQRLEIEIGSNIAYYNNKEIEMEV
PAQVMDSEVIVPIEWISKLFNKTVDKEIGTNSVYITL
Download sequence
Identical sequences A0A072NP48
WP_035194454.1.49761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]