SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A072NWD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072NWD1
Domain Number 1 Region: 71-179
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 1.44e-37
Family FAD-dependent thiol oxidase 0.0000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A072NWD1
Sequence length 217
Comment (tr|A0A072NWD1|A0A072NWD1_9EURO) Sulfhydryl oxidase {ECO:0000256|RuleBase:RU371123} KW=Complete proteome; Reference proteome OX=1182545 OS=Exophiala aquamarina CBS 119918. GN=A1O9_11905 OC=Exophiala.
Sequence
MPRAPPPFMVVLSAVALFVWYVVYTSGHERDVSALSHANRFNIGQGRIQDPRPPVASSEP
VHGDHIMGRLGNETLKADLGRAAWKVLHTTMARFPDKPTADESAALNQYLHLFARLYPCG
ECAEHFQKVLKKYPPQTSSRSSAAAWACFVHNIVNERKGKPIFDCANIGDFYDCGCADEE
KEAISAPGAKSTNIAQGLPLTHHEPVEIEKEGPTKGG
Download sequence
Identical sequences A0A072NWD1
XP_013254506.1.5891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]