SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A072U0J8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072U0J8
Domain Number 1 Region: 87-148
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000471
Family B3 DNA binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A072U0J8
Sequence length 167
Comment (tr|A0A072U0J8|A0A072U0J8_MEDTR) Transmembrane protein, putative {ECO:0000313|EMBL:KEH23197.1} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_7g068970 OC=Trifolieae; Medicago.
Sequence
MHHKYSDYASFVLKFTKNDNTTTRKTMRLLDVLTSQEYDFRLITAERNKAEKSLGRVVCW
HVLYDDKLLFDLGVPPAVLFVEVMLAPSIFREQCLEKKNADLTLIDDNGNKWKCRVVVGT
LTQSNRRIRGQWKTMIDARNIKHGSYMIIGALMSGTINTTFFSIKHL
Download sequence
Identical sequences A0A072U0J8
XP_013449170.1.50012 Medtr7g068970.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]