SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A072U2F6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072U2F6
Domain Number 1 Region: 6-109
Classification Level Classification E-value
Superfamily SRP19 3.4e-35
Family SRP19 0.0000778
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A072U2F6
Sequence length 138
Comment (tr|A0A072U2F6|A0A072U2F6_MEDTR) Signal recognition particle 19 kDa protein {ECO:0000313|EMBL:KEH23892.1} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_7g096570 OC=Trifolieae; Medicago.
Sequence
MEGELPSIKKWIVLYPVYINSKKTVAEGRRIGISKSCENPTCVEIGDCCNFLKLPFAIEL
DKAYPRDFMQRGRVRVLLKNEDGTLINPSIASRKQLMLRVAEMVPKHHGRTKKQETASTT
TATAGPSNKSGKGGKKRR
Download sequence
Identical sequences A0A072U2F6
Medtr7g096570.1 XP_013449864.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]