SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A072U608 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A072U608
Domain Number - Region: 13-33
Classification Level Classification E-value
Superfamily Prim-pol domain 0.085
Family PriA-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A072U608
Sequence length 109
Comment (tr|A0A072U608|A0A072U608_MEDTR) Uncharacterized protein {ECO:0000313|EMBL:KEH24781.1, ECO:0000313|EnsemblPlants:KEH24781} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_6g004730 OC=Trifolieae; Medicago.
Sequence
MCKNYRSSPGDRPGSLHGGTAHVCGPVLIDKLNEDIQLRGLKDQISVMACSHIGVKVEND
EKLANGKNINVESNNENVVGCCQGVDGVVSCCKSQSFEQNKVVDETDKN
Download sequence
Identical sequences A0A072U608
XP_013450753.1.50012 Medtr6g004730.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]