SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A072U953 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072U953
Domain Number 1 Region: 174-236
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000772
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A072U953
Sequence length 273
Comment (tr|A0A072U953|A0A072U953_MEDTR) Helix loop helix DNA-binding domain protein {ECO:0000313|EMBL:KEH26197.1} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_6g047550 OC=Trifolieae; Medicago.
Sequence
MEEINNTTMNVSSTNGWLSDLEMDEYNLFAEESNLNFLETDVVEFLSHDIGNVFLEQNKQ
QCFTSGSTPTSLCNSSSYETNLDSFDFDFDKPNMELKTIDHIHSNKINETFSPKLSPSNS
SIQFQIPSFDNTPNSPTTNSSQLCGLDPTFNSKQNSEIKTSKSKRSRTLHGQDHIMAERK
RREKLTQNFIALAALVPNLKKVDKYSVLVDTIKYLKELKKRLKVLEEQNEKTKIESLVVV
LTKQAFATMTTPPHVMRVLIVLLIYHFKWKQES
Download sequence
Identical sequences A0A072U953
XP_013452169.1.50012 Medtr6g047550.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]