SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A072UT27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A072UT27
Domain Number - Region: 194-269
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0432
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A072UT27
Sequence length 372
Comment (tr|A0A072UT27|A0A072UT27_MEDTR) Membrane-bound O-acyltransferase family MBOAT protein {ECO:0000313|EMBL:KEH32496.1} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_4g125980 OC=Trifolieae; Medicago.
Sequence
MKYGWLIKTGFWFSSKSLRDWPLFMCCLSLAIFPLAAFIVEKLAQRKCIYEHIVVLLHII
IATTAVLYPILVILRCDSAFVSGVTLMLLACIVWLKLVSYAHTNYDLRALTNSIEKGEAL
PNTHMEYAYEVSFKSLAYFMVAPTLCYQPRYPRTPSIRKGWVLRQFVKLIIFTGVMGFII
EQYINPIVKNSQHPFKGNILYAIERVLKLSVPNLYVWLCMFYCFFHLWLNILAELLRFGD
REFYKDWWNARTVEEYWRMWNMPVHKWMIRHLYFPCLRTGIPKGAAVLIAFMVSALFHEL
CIAVPCHIFKLWAFSGIMFQVPLVLITNYLQNKFSNSMVGNMFFWFTFCILGQPMCVLLY
YHDLMNRNSKLD
Download sequence
Identical sequences A0A072UT27
Medtr4g125980.2 XP_013458465.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]