SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A072UWX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072UWX9
Domain Number 1 Region: 11-78
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000409
Family F-box domain 0.0077
Further Details:      
 
Domain Number 2 Region: 92-171
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000677
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A072UWX9
Sequence length 328
Comment (tr|A0A072UWX9|A0A072UWX9_MEDTR) F-box protein SKIP16 {ECO:0000313|EMBL:KEH30345.1} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_4g068130 OC=Trifolieae; Medicago.
Sequence
MDLESVGDLAIHEIMENLKPEDIARISCVSNRFKSFTSDDSLWSKICFRELSLTQPIDHL
GNPTPSFKEAYQTWREAFVMYPWSLVKRVKRCWDNIKTWLTNNFPEAKETLCEGASEVEI
QELEDVLNVKLPLPTRILYRFHNGQEIEKHDHDTSTSDISLGIIGGYSFYDHFVNVYLLP
ISQVIQETQQISHNLGFLRRSKYVLVAASSTYREKLFFLNCTNGQLYVGTRNLLTNRDLM
PCVPQNLISLHHEMDSEKIQDAMLLWLEEHGRRLQRGFIKLLEEGNAKSISLFPEESPVC
STAVTNGVQVGEYILPLMLALLALFIQA
Download sequence
Identical sequences A0A072UWX9
XP_013456314.1.50012 Medtr4g068130.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]