SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A072V8W1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072V8W1
Domain Number 1 Region: 139-228
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 2.51e-22
Family TATA-box binding protein (TBP), C-terminal domain 0.0000524
Further Details:      
 
Domain Number 2 Region: 59-144
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 5.65e-20
Family TATA-box binding protein (TBP), C-terminal domain 0.0000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A072V8W1
Sequence length 230
Comment (tr|A0A072V8W1|A0A072V8W1_MEDTR) TATA-box-binding protein {ECO:0000313|EMBL:KEH34630.1} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_3g066070 OC=Trifolieae; Medicago.
Sequence
MRANSSNTQLKTIMSTIPHTKRNRIRLFKYKGSHLRNHFPTRSRANYIEQQTPMLKSSRN
IVSTVNLDCKLDLNSIKLQAPTAEYNPQRHPAVIMRIRAPESKAQINSFGMMVCTGTKSE
SQSKLAYAAIIRKTGFPTKFKDFKIQEIVGSCDVKFPIHLQRLAHSHAACSSYNPVLFPW
QIYEMKQAKIVLHIFDSGKIHLKGTKSRDEIFTAFENIYPVLTEFRKNQQ
Download sequence
Identical sequences A0A072V8W1
Medtr3g066070.2 Medtr3g066070.3 XP_013460596.1.50012 XP_013460597.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]