SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A072VFN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A072VFN9
Domain Number - Region: 89-118
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.017
Family Pseudo ankyrin repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A072VFN9
Sequence length 257
Comment (tr|A0A072VFN9|A0A072VFN9_MEDTR) Uncharacterized protein {ECO:0000313|EMBL:KEH40263.1, ECO:0000313|EnsemblPlants:KEH40263} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_1g026480 OC=Trifolieae; Medicago.
Sequence
MVRQRKSVLISLLFSQVNWFLNYKALALKAVFLLLTSGHPESWVITNSCSECCKMSIVHY
ILLEDENFNEALNVLERIKLDGIQLDVLLFNTFLRQACYKGRIDVIEFIVEFMHQEKVQP
DPTTCGYVFSAYVNSSFHNTAVEALQVLSLRMMSVDGNILQERKNFVDEFILDEDLASES
HIFKLFEDSEDKVAIGLWNLRWCAMIGFPIYYMIVYPLHKKQICDGVREKRGDRRRRDVS
RSGEGGCGDEAKDSGRK
Download sequence
Identical sequences A0A072VFN9
Medtr1g026480.1 XP_013466222.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]