SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A072WSB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A072WSB9
Domain Number - Region: 314-393,431-439
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0915
Family Pseudo ankyrin repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A072WSB9
Sequence length 479
Comment (tr|A0A072WSB9|A0A072WSB9_CLOBO) Transposase {ECO:0000313|EMBL:KEH90573.1} KW=Complete proteome OX=1443126 OS=Clostridium botulinum C/D str. It1. GN=Z963_11665 OC=Clostridium.
Sequence
MLTNNERKQNQLELVYIENLVPENHILRKIDKYIDFSFIRDLTKDLYCPDNGRPSVDPVV
LFKMLFIGYLFGIRSERQLVKEIQVNVAYRWFLGYGLTDKIPSHSTISQNRTKRFSNTNI
HQEIFDNIVFQAINRNLVDGKILYTDSTHLKANANKHKFIKKEITKSTKEYFDELENDIN
KDRINHNKKPLKKKTKIAETKEIKVSTTDPDSGYMVRDGKPKGFFYLDHRTVDGKYNIIT
DVHVTPGNINDVDPYVKRIETQIEKFNFNTKYLVADAGYSTNPICKQISDKNYQGVFGFR
LGPHVKGKYTKYRFQYVKELDGYVCINNCFLKYRTTTREGYKEYLSNAEHCAYCKYKNNC
LTSDKSINRTIRRHVWEDYKDQIFRFTKTEKGKSIYKRRKEKIERSFADSKELHGLRYCR
MRGIKNVSEQCLLTAAVQNMKKIAMVLSHYFLCTLIQIYSKLTYIINIFRMLSHKRILA
Download sequence
Identical sequences A0A072WSB9 A0PZ18
386415.NT01CX_0769 386415.NT01CX_1539 WP_011721628.1.12664 WP_011721628.1.95864 gi|118443157|ref|YP_877620.1| gi|118445140|ref|YP_879235.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]