SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A072XFA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A072XFA8
Domain Number - Region: 21-65
Classification Level Classification E-value
Superfamily Homing endonucleases 0.034
Family Group I mobile intron endonuclease 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A072XFA8
Sequence length 104
Comment (tr|A0A072XFA8|A0A072XFA8_CLOBO) Uncharacterized protein {ECO:0000313|EMBL:KEH98166.1} KW=Complete proteome OX=1443125 OS=Clostridium botulinum C/D str. BKT12695. GN=Z962_13205 OC=Clostridium.
Sequence
MDWKMVIKTRVEEYNRKKHRISTALNNMIEELRNEIGVAAIVIEEERLGKMYWRVRINGK
EECISYDEVKLNMFVPVLNPKEENEKVSLEEVLEKILLEKFKWN
Download sequence
Identical sequences A0A072XFA8 B1BDW3
WP_003368168.1.21839 WP_003368168.1.2299 WP_003368168.1.59779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]