SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A072YK42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072YK42
Domain Number 1 Region: 56-181
Classification Level Classification E-value
Superfamily Ferritin-like 1.27e-33
Family Ferritin 0.0061
Further Details:      
 
Domain Number 2 Region: 1-38
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0000000000121
Family Rubredoxin 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A072YK42
Sequence length 182
Comment (tr|A0A072YK42|A0A072YK42_CLONO) Reverse rubrerythrin-1 {ECO:0000313|EMBL:KEI12312.1} KW=Complete proteome OX=1443122 OS=Clostridium novyi B str. NCTC 9691. GN=Z958_07930 OC=Clostridium.
Sequence
MKKFVCTVCGYIHEGEEAPAFCPQCKASKDKFVEKKEDENLEWADEHRVGIAKDVDPEVI
EALRANFTGECTEVGMYLAMSRQADREGYPEVAEAYKRIAWEEAEHAAKFAELLGEVVTD
DTKTNLKVRVEAEYGACDGKKKLATLAKALNYDAIHDTVHEMCKDEARHGSAFRGLLNRY
FS
Download sequence
Identical sequences A0A072YK42 A0A0A0IKU3
WP_039216866.1.2865 WP_039216866.1.50245 WP_039216866.1.53713 WP_039216866.1.86644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]