SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A072YLK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072YLK8
Domain Number 1 Region: 3-207
Classification Level Classification E-value
Superfamily Methenyltetrahydrofolate cyclohydrolase-like 3.14e-52
Family Methenyltetrahydrofolate cyclohydrolase-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A072YLK8
Sequence length 207
Comment (tr|A0A072YLK8|A0A072YLK8_CLONO) Methenyltetrahydrofolate cyclohydrolase {ECO:0000313|EMBL:KEI12857.1} KW=Complete proteome OX=1443122 OS=Clostridium novyi B str. NCTC 9691. GN=Z958_05390 OC=Clostridium.
Sequence
MFIEEYINKLSSKEPTPGGGSAAALVSSLSSSLTAMMLSLTIGKKLYESYNDKLKKDIDE
TLKESNEYNDLFLDYMDKDEEAFLTLMDAYKLPKNDDKEKSIRKKEIENGYEKALIIPLN
LARESLKFYEKILTTVKYGNPNLISDGGVAAILLYSAIESCMLNVKINLSGITDELKRED
IINECNSILEKSLNYKMNIMDIVESKI
Download sequence
Identical sequences A0A072YLK8
WP_052100994.1.2865 WP_052100994.1.32577 WP_052100994.1.50245 WP_052100994.1.53713 WP_052100994.1.86644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]