SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A073JNH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A073JNH4
Domain Number 1 Region: 11-124
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 1.09e-39
Family N-utilization substance G protein NusG, N-terminal domain 0.000067
Further Details:      
 
Domain Number 2 Region: 117-184
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 7.31e-17
Family N-utilization substance G protein NusG, C-terminal domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A073JNH4
Sequence length 186
Comment (tr|A0A073JNH4|A0A073JNH4_LACRE) Transcription termination/antitermination protein NusG {ECO:0000256|HAMAP-Rule:MF_00948, ECO:0000256|RuleBase:RU000538, ECO:0000256|SAAS:SAAS00126873} KW=Complete proteome OX=1598 OS=Lactobacillus reuteri. GN=LR3_02280 OC=Lactobacillus.
Sequence
MIGGFIVESHEKRWYVLHTYSGYENRVKSNLESRAQSMGMEDYIFRVVVPEEEVRQVKDG
QAKETIEKTFPGYVLVEMVMTDQAWYIARNTPGVTGFLGSHGGGSKPTPLLSEEVDRIMK
RMGTETTVSDIDVKEGDTVKVIAGSFANMTAKVVEVDHEKQKIKATVEMFGRETAAELGF
DQIDTF
Download sequence
Identical sequences A0A073JNH4
WP_080707480.1.21867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]