SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A073JSD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A073JSD4
Domain Number 1 Region: 3-155
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.49e-23
Family SMI1/KNR4-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A073JSD4
Sequence length 156
Comment (tr|A0A073JSD4|A0A073JSD4_9BACI) Cell wall assembly protein {ECO:0000313|EMBL:KEK17959.1} KW=Complete proteome; Reference proteome OX=574376 OS=Bacillus manliponensis. GN=BAMA_07955 OC=Bacillus cereus group.
Sequence
MKIDEKTSVKPFPSDERIAWFEQSYRIKLPQSYIDFLKKYNGATPITNVLKIDRQEYVIE
RFLCLLDNPKEHSVDGWYDLTSVLTQLDGRLIDDEELIGMNIIPIAAMFAGDFICLDFRN
SENPEIVIWDHEESEELEPATTVIASSFEEFLTMLS
Download sequence
Identical sequences A0A073JSD4
WP_034642098.1.33474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]