SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A073JUX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A073JUX2
Domain Number 1 Region: 16-140
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000589
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A073JUX2
Sequence length 142
Comment (tr|A0A073JUX2|A0A073JUX2_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KEK17956.1} KW=Complete proteome; Reference proteome OX=574376 OS=Bacillus manliponensis. GN=BAMA_07935 OC=Bacillus cereus group.
Sequence
MNVLPDNLEQVLEEDIYKREDKNKVKETLTNLGVEVSDTFREFYYRYAGPFWEEHVPYEL
LDVVDEENNIESYTIIARNEHGFPKKYLVLSEMSANAILVLDSVTDKVYSVNFEGGDELL
LSGELEETWPTFYEFLKEYFNC
Download sequence
Identical sequences A0A073JUX2 A0A2A7HME8 A0A2B4KRV7 A0A2C3KL03
WP_034642087.1.101720 WP_034642087.1.33474 WP_034642087.1.54240 WP_034642087.1.61820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]