SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074L1F5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074L1F5
Domain Number 1 Region: 2-82
Classification Level Classification E-value
Superfamily LigB-like 0.00000000000165
Family LigB-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A074L1F5
Sequence length 97
Comment (tr|A0A074L1F5|A0A074L1F5_9MICO) Uncharacterized protein {ECO:0000313|EMBL:KEO74330.1} KW=Complete proteome; Reference proteome OX=1497974 OS=Georgenia sp. SUBG003. GN=DA06_28130 OC=Bacteria; Actinobacteria; Micrococcales; Bogoriellaceae; Georgenia.
Sequence
MAELTAVLASTHHPFYYKATTSPPDQRPPYAAEWQRKVEAYRETLTAAEPDVLVMVGADH
FHQFFLDNYPQFLIGKQETYDATFYNEEREFGIPGTS
Download sequence
Identical sequences A0A074L1F5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]