SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074LBL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074LBL8
Domain Number 1 Region: 1-54
Classification Level Classification E-value
Superfamily BAS1536-like 0.00000000000667
Family BAS1536-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A074LBL8
Sequence length 75
Comment (tr|A0A074LBL8|A0A074LBL8_PAEPO) Uncharacterized protein {ECO:0000313|EMBL:KEO78544.1} KW=Complete proteome OX=1406 OS=Paenibacillus polymyxa (Bacillus polymyxa). GN=EL23_09065 OC=Paenibacillus.
Sequence
MKWKQLEECIEEKRKELNDLANEVGLKDRRVLTKSMELDRLLNKYSDWKYSYRRQQSIPQ
SSQIQEKQHELVLSY
Download sequence
Identical sequences A0A074LBL8
WP_039271422.1.78774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]