SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074LBV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074LBV6
Domain Number 1 Region: 147-280
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.33e-30
Family AadK C-terminal domain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 6-133
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.51e-22
Family AadK N-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A074LBV6
Sequence length 284
Comment (tr|A0A074LBV6|A0A074LBV6_PAEPO) Uncharacterized protein {ECO:0000313|EMBL:KEO79696.1} KW=Complete proteome OX=1406 OS=Paenibacillus polymyxa (Bacillus polymyxa). GN=EL23_05060 OC=Paenibacillus.
Sequence
MNNAYEVLEERISEWGISNEEIIAVYIVGSRAREDKPFDEFSDLDVVVFSTNPDYYLQND
QWLLNIGKVWTSFMFRTAKGDPEKLVLFDQGAEVDFLFRHISDLDHIIKNRRIPEGFQRG
VRMLLDKTGNGNQIISQTTTIPDTPPISEGAYLQVVNMYCFASLYVAKQILRNDLWVAKQ
RDMDCKQLLLQMIEWHAKAVHGSEYDTWHAGKFMNEWADQDVVTDLKKSFGKYDPNHSWE
ALVVSLKLFKRLSSEVAAKYKYAYPDELFSHIQNWLGGQYDKHR
Download sequence
Identical sequences A0A074LBV6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]