SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074LGQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074LGQ4
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily MbtH-like 6.8e-28
Family MbtH-like 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A074LGQ4
Sequence length 72
Comment (tr|A0A074LGQ4|A0A074LGQ4_PAEPO) Protein mbtH {ECO:0000313|EMBL:KEO80349.1} KW=Complete proteome OX=1406 OS=Paenibacillus polymyxa (Bacillus polymyxa). GN=EL23_02105 OC=Paenibacillus.
Sequence
MINPFEQNEGGYLVLMNGEGQYSLWPDFQHVPTGWEVVHPTDSREACMNYISTHWTDMRP
DSLHPKADAVRR
Download sequence
Identical sequences A0A074LGQ4
WP_029516437.1.78023 WP_029516437.1.78774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]