SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074PW50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074PW50
Domain Number 1 Region: 4-110
Classification Level Classification E-value
Superfamily Thermostable phytase (3-phytase) 0.00000000000000222
Family Thermostable phytase (3-phytase) 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A074PW50
Sequence length 114
Comment (tr|A0A074PW50|A0A074PW50_9MICO) Uncharacterized protein {ECO:0000313|EMBL:KEP23397.1} KW=Complete proteome; Reference proteome OX=1497974 OS=Georgenia sp. SUBG003. GN=DA06_08890 OC=Bacteria; Actinobacteria; Micrococcales; Bogoriellaceae; Georgenia.
Sequence
MVGAGHLVADVEGVTIARDRTSSSGHLIVSCQGNHTFQVYDLAAPHTWRKQFTVAGSSAN
GTDAVTSSDGVDVTRAALGTTFPQGVFVTHDAANTGGQMSNFKLVDAGDVLGDY
Download sequence
Identical sequences A0A074PW50

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]