SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074RJ95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074RJ95
Domain Number 1 Region: 34-66,135-205
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000000986
Family Regulator of G-protein signaling, RGS 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A074RJ95
Sequence length 428
Comment (tr|A0A074RJ95|A0A074RJ95_9HOMO) Regulator of G protein signaling superfamily protein {ECO:0000313|EMBL:KEP46884.1} KW=Complete proteome; Reference proteome OX=1423351 OS=Rhizoctonia solani 123E. GN=V565_177180 OC=Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia.
Sequence
MYAARLSRWAGRRATRKLVNRIRLVNILSGDACSPLGLEEFEAYVALQEHSLENLQFIIW
YHDYQQRFFALNAEEQALSPPLVQPLNISPPTPTYSRGKKSVPESPPSSDWGLSPTSSAS
SWYPWSPITIPSTVPLKDQPFRNETLQIVATFIRPGAKKELNLDADIREELLRGLEKSTH
PDIFAPAYARIYELVDGCSVPNFVSNAAANINLPKQVYWYAIGVIFTLISWLIAIFTIYF
IPDHPRSKRSVRLVSVPFAVLGCMQIYSAWRGFCSQVFGRSARQLHTWELVDPADAGVSL
QTLAPIPVLPVKPPPLRNVLDMAAGTSKRAVAPFVNLPSTSSLEMADLSTKSHPDGSSGT
RIAIIDPEPLGRAGRAAFRRPAVYGPERVVEDPRVRAYHRGVIRDMLWVGFGWGLAWTGI
LVGIPGRG
Download sequence
Identical sequences A0A074RJ95 X8JSN6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]