SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074RSQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A074RSQ5
Domain Number - Region: 50-145,175-197
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000106
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A074RSQ5
Sequence length 482
Comment (tr|A0A074RSQ5|A0A074RSQ5_9HOMO) Putative transmembrane protein {ECO:0000313|EMBL:KEP49899.1} KW=Complete proteome; Reference proteome OX=1423351 OS=Rhizoctonia solani 123E. GN=V565_090700 OC=Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia.
Sequence
MASYSRPPHYPYSFKAFKDVPRRLFCPPRSEIKIGRVRSMSLTPLFEVKLADVLDGQHLP
PLSRKDFEEYLLFVEHSPENLYFFEWLRGYTKAYTAWAQTGTPYSAPLALSWSRAKQTFL
ANDAHYKLNLSTTALEGLPQVSEPAQQPRPISSVAMSQEPSSSSQDRPTQPSYPSPIALT
KIKSEVEDMLRESLNRFVCGSCGNSGRARGLFGIALGVITLAIGLAPVLVSILHGRGGRG
LRAAAIPIFWLGAWVTIMSLHGVCILIFLFGDARQLYPYELARPKITAPIDKHQATMISS
PKIQPHNNSEKFGDPVNQMHVDLEQGHMGSCSSASTIGKQSRHLSASSMEHGAHQARGES
CELTVIASPQTATLSPMSAHNLMQQPSAGTGTVMSPQRWSFDFDALPGPTPNPVADPDQW
GSTLPVRPEEKFGAIPTFGPLTKVLSPIVTRAQWEIVVRSAIMALIVAVILGAICLAVPA
KR
Download sequence
Identical sequences A0A074RSQ5 X8J491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]