SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074RUS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074RUS0
Domain Number 1 Region: 25-181
Classification Level Classification E-value
Superfamily Lipocalins 0.0000207
Family Retinol binding protein-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A074RUS0
Sequence length 195
Comment (tr|A0A074RUS0|A0A074RUS0_9HOMO) Putative TrfA domain protein {ECO:0000313|EMBL:KEP48383.1} KW=Complete proteome; Reference proteome OX=1423351 OS=Rhizoctonia solani 123E. GN=V565_126110 OC=Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia.
Sequence
MTGPLLYPEIIIHQPDSFHPSLSREQFDIEKFMGKWHVVQSTLPLWKSRSDVTITYSQIA
TSSPDVVKFDDIVEYRSRASPGSARSRIVGVDTLVTTHHGAPEGYKSGVSYHWRGKGWLM
IATSNWQVLGYNPDLGWAVTYFSKTLFTPAGLDVYVRDPIRVNGEVVKGILEATKKVGGE
IGSLAEDFFQVPVTE
Download sequence
Identical sequences A0A074RUS0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]