SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074STA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074STA2
Domain Number 1 Region: 30-70
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000471
Family Ovomucoid domain III-like 0.0031
Further Details:      
 
Domain Number 2 Region: 397-436
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000624
Family Ovomucoid domain III-like 0.0039
Further Details:      
 
Domain Number 3 Region: 315-354
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000277
Family Ovomucoid domain III-like 0.004
Further Details:      
 
Domain Number 4 Region: 273-311
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000112
Family Ovomucoid domain III-like 0.0043
Further Details:      
 
Domain Number 5 Region: 574-610
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000291
Family Ovomucoid domain III-like 0.0047
Further Details:      
 
Domain Number 6 Region: 439-477
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000596
Family Ovomucoid domain III-like 0.0037
Further Details:      
 
Domain Number 7 Region: 357-394
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000776
Family Ovomucoid domain III-like 0.0031
Further Details:      
 
Domain Number 8 Region: 142-180
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000887
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 9 Region: 183-221
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000137
Family Ovomucoid domain III-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A074STA2
Sequence length 644
Comment (tr|A0A074STA2|A0A074STA2_HAMHA) Kazal-type serine protease inhibitor domain-containing protein {ECO:0000313|EMBL:KEP60925.1} KW=Complete proteome; Reference proteome OX=99158 OS=Hammondia hammondi (Parasitic protozoan). GN=HHA_266610 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Hammondia.
Sequence
MGRVSKLGLVVATGAMYLAVCKAQPDETKPVCACPKNLAPVCGVNGQTYGNQCLLECHGI
ELLKEGPCSPAPPSGGEEEIPIACPLNEFPVCGTDELLDIRRPCYNAKHFIEAVMKLSGR
KQRLDPLAGAEKGASTTSGSTDCQCDASVVVNCGVDGKTYSNHCLRECNGVQLRHLGYCT
TGVCRCPQKVELNCGVDNNTYYNHCMRKCDGVQLNYEGPCTSQKTEALSGNLQLRVASPR
IANSSSSPTTEDTSDILPQQPSLAQNNQDPLASCHCPLKVELNCGVDGKTYANNCLRECD
SVAIQHEGPCEPGDCPCSSRFYEPNCGADKLTYANHCLRQCAKVDLFHEGPCTDEECGCP
LTLNINCGMDGKTYPNSCLRECQGVGLKGPGSCDRYDACFCPKINEPNCGADGKTYVSHC
FRECHDVELKHEGRCTEEDCLCSPTFELNCGEDGTTYANHCMRECQGVSLGSLGPCPFSE
QKPSFPNVTTTTTTTTVATTTTSVATTTTTVATMATSVATMTTAMTTATLATTAAPTNST
ISSSSNTNDPSSTPDAAPAGATIRFSHKQTRCDMCPPTVFLNCGENGTTYENHCQRECQG
VRLLHEGPCELQDKRRYRGISKIPEPGFPGVIGAPMRTIRRMDY
Download sequence
Identical sequences A0A074STA2
XP_008888423.1.28481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]