SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074SVK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074SVK0
Domain Number 1 Region: 137-251
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000639
Family Regulator of G-protein signaling, RGS 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A074SVK0
Sequence length 542
Comment (tr|A0A074SVK0|A0A074SVK0_9HOMO) Putative transmembrane protein {ECO:0000313|EMBL:KEP53932.1} KW=Complete proteome; Reference proteome OX=1423351 OS=Rhizoctonia solani 123E. GN=V565_024540 OC=Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia.
Sequence
MRADYKCIALNRLGCPIARLFSQPCLLLLVTMPQPPVTLNLQSSPFEGIEVTDGNRSGSP
IKASKTYPPHLNPAMSTPQDNSIPPRPPAFVFSASTLLEIPGRLSHPPSIKSIGKQWVIV
PEMAVSLDDILAMRHLSPLSLKDFEQYLLFEEYGAENLYFLLWLNDYTAQFHSGGSPRGL
YYSVARAKATFFSSDSQYELNLAAVRISEFYALVDSAPGKSPAPPHPDSFVAIRGDVEVM
LRTSARRFVQSRSQNASTQRALCITFGGLLTMAIALAPLMVSRFSEHNRYIRFGMIPPLW
LGFTVFLSSVNGVCLVLYLMGGSRQLHPFELIRPAISTPVQHESRSIYQASLVTLDSTHD
AKVPPISSSASSFVQYPSATHALQGMQPPDHFSAPPNVYVLPQIRPSTPIMQSRFDFETA
AFIPCQEDDCTTMSDQASTYGESTSADSTSAPSATTRSSATKLAFDFDALPAKTLTSTTG
PPILRAAGGKGIKRLITKAFGPVTRVRSPVISRAQWEVAIRSMVVAAMVALIVSGVLVAA
PI
Download sequence
Identical sequences A0A074SVK0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]