SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074TS30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074TS30
Domain Number 1 Region: 13-146
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 1.7e-46
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.00000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A074TS30
Sequence length 147
Comment (tr|A0A074TS30|A0A074TS30_9MICO) Ribonucleotide-diphosphate reductase subunit alpha {ECO:0000313|EMBL:KEP72905.1} KW=Complete proteome; Reference proteome OX=1504156 OS=Microbacterium sp. SUBG005. GN=HR12_39210 OC=Microbacterium.
Sequence
MDFKTEARFEGLDYHALNAMLNLYDADGKIQFDADKRAAREYFLQHVNQNTVFFHSLKER
LDYLVEKEYYEPTVLAKYSMEFIQELNDRAYGAKFRFETFLGAFKYYTSYTLKTFDGKRY
LERFEDRVVMTALALADGDQRLAVQLV
Download sequence
Identical sequences A0A074TS30

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]