SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074TVH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074TVH8
Domain Number 1 Region: 85-203
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 0.00000068
Family Major surface antigen p30, SAG1 0.013
Further Details:      
 
Domain Number 2 Region: 5-70
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 0.0000562
Family Major surface antigen p30, SAG1 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A074TVH8
Sequence length 252
Comment (tr|A0A074TVH8|A0A074TVH8_HAMHA) SAG-related sequence protein {ECO:0000313|EMBL:KEP66367.1} KW=Complete proteome; Reference proteome OX=99158 OS=Hammondia hammondi (Parasitic protozoan). GN=HHA_450690 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Hammondia.
Sequence
MIQRVCEDENCERPKPLTDVFRGASRTDDPAKHVYKLTIPKGNRPQKDVWYQCRSQLRTN
PCKVKIRVAAAPTAPPATSQENKCTSAGDVLNVSASPASPLKFICTKGLSLQPADKHVYE
ISDDQCQKKVELCTLVDAQLTEVTQPTFTSGDTTYTLPINKLPPKKALLCYKCAATYAHL
NSLRMSTGRDAKPECLVKVTVEADPTATNTWTMPTETPSTPTTFSAMLHGRALAVSHNVV
GVSLLAGARYTL
Download sequence
Identical sequences A0A074TVH8
XP_008883075.1.28481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]