SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074VHX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074VHX1
Domain Number 1 Region: 4-50
Classification Level Classification E-value
Superfamily beta-Roll 3.92e-16
Family Serralysin-like metalloprotease, C-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A074VHX1
Sequence length 51
Comment (tr|A0A074VHX1|A0A074VHX1_9NEIS) Uncharacterized protein {ECO:0000313|EMBL:KEQ02000.1} KW=Complete proteome OX=1385367 OS=Snodgrassella alvi SCGC AB-598-J21. GN=SASC598J21_002210 OC=Neisseriaceae; Snodgrassella.
Sequence
MPVPGDNGDDVIYGGSGDDKLFGGDGDDWLYGGKGNDYLNGGLGNDIFIFK
Download sequence
Identical sequences A0A074VHX1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]