SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074VLE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074VLE6
Domain Number 1 Region: 846-974
Classification Level Classification E-value
Superfamily PX domain 1.44e-24
Family PX domain 0.001
Further Details:      
 
Domain Number 2 Region: 412-560
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.03e-19
Family Regulator of G-protein signaling, RGS 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A074VLE6
Sequence length 1218
Comment (tr|A0A074VLE6|A0A074VLE6_9PEZI) Intermediate filament, regulator of G-protein signaling {ECO:0000313|EMBL:KEQ61530.1} KW=Complete proteome; Reference proteome OX=1043003 OS=Aureobasidium melanogenum CBS 110374. GN=M437DRAFT_76203 OC=Aureobasidium.
Sequence
MSLEKKDVITAGVAAFVSWLLLTHWVPSFRWIPYAFVTGCLATLAGLAFLLLTSSKGPNY
RYNHATTIKPPAFVTPALWKQEKAALKARSRYDKTPIYPSSANVSLSIDALLDYVLRDFI
TVWYKNISLRPLFQNEVDRAIRQVLDNVRRRTQQLDMVELGVARIVPILTNHMRDFYNAE
RIVRGKNLSRDMTESEELDLAIAAKFRDGKLHPAAALAFSDTKLLQQTHLRRLIAKILPL
VMPEYMKTSAAVTTLVKEIVACAVLTPIVLMLSDPDFFNQLIENSGRTMLQDRKSVRKLR
AALDEHAVPTPQHPKAAQFPRLRPNDNERQFERFIRATRNCATLSDARRFRSEISSQVRK
ATSGPEQDPVYLRRLESGRRILDQKIAHFTAGGSARPKLTVKASTSSIEHTSRLSQASLD
EVLHNASGLSYFMEFMDRKSRMRLVQFWIVVDGFRNPLEGDNDEPEQELQDTPWTPSDRM
DLEQMYEAYLTKPELNVPDHDRRTVRDFLRAGRTADARLYVSARRAVLRAQTAVFEEMKE
QHFENFRKSDLFYKWLATEESSILSATSDGHQELSRSLSVGGERDRPLHREARPATVLSP
KSPRAPELKRPALSSTDLKSFIKPGVVASPVRQSMDGGRPRPLFDDDVEDERMTRSVSAL
SSMDLDIDGEQPHDDSAQVVDAMQAALNEIMDEPDNGSIFSSESLGVSNDSPRTSLDGVR
PPLVQTRSKPSIASLGLVGAVSSKGVFEDDLFGEEEKFAEDEKEDSDLDEKSIEDDIHEA
APGDLGLTEAISTLNADIDRLTAQDAILDSLTKKAELTNNAAELRILRKSKQSLAREIHR
KEMQKQQYTIQESDNSLYGRAAVNIKSIMVGREEDGHEFALYVIEVRRQAGDQMPAAVWM
VTRRYSEFHELNKRLRERFPAVRNLEFPRRQTLFTLQKDFLQKRRVILEKYLKALLLIPA
ICRSRELRAFLSQSRITSSANGSQIDEKDFVTRIYNSVTDGMEEFLGNIPVLDQLSVAGQ
NLISAATAQMSGVPLNPNAPEFSSDPASAAEAEAEINAFEDREAEPFVKPICDIFLEIFE
LQKGTSWLRGRAVVVVLHQLLGGTIERKVRDAAKGFGQEDTIIRYLDLVKNIMWPDGQMK
QGGVPRTAAQKAASQKEAGLLLATLVPDLAGSVVGRQNAQAASRKVFAMLNNQRLNTHLV
FTLLDELIGAVFPEAVTR
Download sequence
Identical sequences A0A074VLE6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]