SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A074WNV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074WNV9
Domain Number 1 Region: 8-112
Classification Level Classification E-value
Superfamily Prefoldin 3.92e-27
Family Prefoldin 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A074WNV9
Sequence length 125
Comment (tr|A0A074WNV9|A0A074WNV9_9PEZI) Prefoldin subunit 6 {ECO:0000313|EMBL:KEQ64116.1} KW=Complete proteome; Reference proteome OX=1043003 OS=Aureobasidium melanogenum CBS 110374. GN=M437DRAFT_45003 OC=Aureobasidium.
Sequence
MASPEQQKQLQALSDEYTSLQNELQTTVAARQKLESQQQENKGVKSEFANLDDDANIYKL
VGPILLKQDVSEAKSTVDGRLEFIDKEINRIEKQISDIQAKSEEKKMAVFQLQTEIQQSG
QPAAA
Download sequence
Identical sequences A0A074WNV9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]